Plant Transcription Factor Database
Previous version: v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; Liliopsida; Petrosaviidae; commelinids; Poales; Poaceae; PACMAD clade; Chloridoideae; Zoysieae; Zoysiinae; Zoysia
Family WRKY
Protein Properties Length: 216aa    MW: 23029.9 Da    PI: 8.9608
Description WRKY family protein
Gene Model
Gene Model ID Type Source Coding Sequence Nucleic Acid
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
                                   ---SS-EEEEEEE--TT-SS-EEEEEE-STT---EEEEEE-SSSTTEEEEEEES--SS- CS
                          WRKY   1 ldDgynWrKYGqKevkgsefprsYYrCtsagCpvkkkversaedpkvveitYegeHnhe 59 
                                   ldDg++WrKYG+K vk+s++pr+YYrC+ +gC vkk+ver+ +dp++v++tY g Hnh 108 LDDGFRWRKYGKKAVKSSPNPRNYYRCAAEGCGVKKRVERDCDDPSYVVTTYDGVHNHA 166
                                   59********************************************************6 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
Gene3DG3DSA: domain
SuperFamilySSF1182901.57E-26100166IPR003657WRKY domain
PROSITE profilePS5081129.413103168IPR003657WRKY domain
SMARTSM007744.4E-33108167IPR003657WRKY domain
PfamPF031061.6E-23109165IPR003657WRKY domain
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0006355Biological Processregulation of transcription, DNA-templated
GO:0003700Molecular Functiontranscription factor activity, sequence-specific DNA binding
GO:0043565Molecular Functionsequence-specific DNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 216 aa     Download sequence    Send to blast
3D Structure ? help Back to Top
PDB ID Evalue Query Start Query End Hit Start Hit End Description
2lex_A2e-2698165774Probable WRKY transcription factor 4
1wj2_A2e-2698165774Probable WRKY transcription factor 4
Search in ModeBase
Annotation -- Nucleotide ? help Back to Top
Source Hit ID E-value Description
GenBankKU0586131e-90KU058613.1 UNVERIFIED: Panicum miliaceum WRKY28-like gene, complete sequence.
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_004968484.16e-54PREDICTED: probable WRKY transcription factor 58
TrEMBLK3XL486e-54K3XL48_SETIT; Uncharacterized protein
STRINGSi002621m2e-53(Setaria italica)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT5G64810.19e-39WRKY DNA-binding protein 51